Recombinant Human SYN2
| Cat.No. : | SYN2-31489TH |
| Product Overview : | Recombinant fragment of Human Synapsin II with N terminal proprietary tag, 36.74kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 101 amino acids |
| Description : | This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. The TIMP4 gene is located within an intron of this gene and is transcribed in the opposite direction. Mutations in this gene may be associated with abnormal presynaptic function and schizophrenia. Alternative splicing of this gene results in two transcripts. |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEV MDCSMPLIGEHQVEDRQLITELVISKMNQLLSRTPALSPQ RPLTTQQPQSGTLKDPDSSKT |
| Gene Name | SYN2 synapsin II [ Homo sapiens ] |
| Official Symbol | SYN2 |
| Synonyms | SYN2; synapsin II; synapsin-2; SYNII; SYNIIa; SYNIIb; |
| Gene ID | 6854 |
| mRNA Refseq | NM_133625 |
| Protein Refseq | NP_598328 |
| MIM | 600755 |
| Uniprot ID | Q92777 |
| Chromosome Location | 3 |
| Pathway | Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter Release Cycle, organism-specific biosystem; Serotonin Neurotransmitter Release Cycle, organism-specific biosystem; Transmission across Chemical Synapses, organism-specific biosystem; |
| Function | ATP binding; ligase activity; |
| ◆ Recombinant Proteins | ||
| Syn2-4344R | Recombinant Rat Syn2 protein, His-tagged | +Inquiry |
| SYN2-5520R | Recombinant Rat SYN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYN2-3071H | Recombinant Human SYN2, His-tagged | +Inquiry |
| SYN2-31489TH | Recombinant Human SYN2 | +Inquiry |
| SYN2-5861R | Recombinant Rat SYN2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYN2 Products
Required fields are marked with *
My Review for All SYN2 Products
Required fields are marked with *
