"TAB1" Related Products

Expand
Expand

Recombinant Human TAB1, His-tagged

Cat.No.: TAB1-30837TH
Product Overview: Recombinant fragment, corresponding to amino acids 4-504 of Human TAB1 with N terminal His tag; Predicted MWt 55 kDa.
Description: The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKG TESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVA QRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLE SIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKT LEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDG LQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIIC GQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIH GAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAA MIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERA RFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYP VSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTL DEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSR PAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTA P
Sequence Similarities: Contains 1 PP2C-like domain.
Gene Name: TAB1 TGF-beta activated kinase 1/MAP3K7 binding protein 1 [ Homo sapiens ]
Official Symbol: TAB1
Synonyms: TAB1; TGF-beta activated kinase 1/MAP3K7 binding protein 1; MAP3K7IP1, mitogen activated protein kinase kinase kinase 7 interacting protein 1; TGF-beta-activated kinase 1 and MAP3K7-binding protein 1; mitogen activated protein kinase kinase kinase 7 inte
Gene ID: 10454
mRNA Refseq: NM_006116
Protein Refseq: NP_006107
MIM: 602615
Uniprot ID: Q15750
Chromosome Location: 22q13.1
Pathway: Activated TLR4 signalling, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IL1-mediated signaling events, organism-specific biosystem;
Function: catalytic activity; enzyme activator activity; kinase activator activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.