Recombinant Human TAB1, His-tagged
Cat.No. : | TAB1-30837TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 4-504 of Human TAB1 with N terminal His tag; Predicted MWt 55 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 4-504 a.a. |
Description : | The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKG TESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVA QRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLE SIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKT LEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDG LQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIIC GQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIH GAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAA MIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERA RFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYP VSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTL DEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSR PAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTA P |
Sequence Similarities : | Contains 1 PP2C-like domain. |
Gene Name | TAB1 TGF-beta activated kinase 1/MAP3K7 binding protein 1 [ Homo sapiens ] |
Official Symbol | TAB1 |
Synonyms | TAB1; TGF-beta activated kinase 1/MAP3K7 binding protein 1; MAP3K7IP1, mitogen activated protein kinase kinase kinase 7 interacting protein 1; TGF-beta-activated kinase 1 and MAP3K7-binding protein 1; mitogen activated protein kinase kinase kinase 7 inte |
Gene ID | 10454 |
mRNA Refseq | NM_006116 |
Protein Refseq | NP_006107 |
MIM | 602615 |
Uniprot ID | Q15750 |
Chromosome Location | 22q13.1 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IL1-mediated signaling events, organism-specific biosystem; |
Function | catalytic activity; enzyme activator activity; kinase activator activity; protein binding; |
◆ Recombinant Proteins | ||
TAB1-0633H | Recombinant Human TAB1 Protein (M1-G370), Tag Free | +Inquiry |
TAB1-4413R | Recombinant Rhesus Macaque TAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAB1-1772HFL | Recombinant Full Length Human TAB1 Protein, C-Flag-tagged | +Inquiry |
TAB1-8951M | Recombinant Mouse TAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAB1-22H | Recombinant Human TAB1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAB1-1292HCL | Recombinant Human TAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAB1 Products
Required fields are marked with *
My Review for All TAB1 Products
Required fields are marked with *
0
Inquiry Basket