Recombinant Full Length Human TAB1 Protein, C-Flag-tagged
Cat.No. : | TAB1-1772HFL |
Product Overview : | Recombinant Full Length Human TAB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNG YDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVP QHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTE NEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDG VTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAR FCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRL WSVDHGEQSVVTAP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | MAPK signaling pathway, NOD-like receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | TAB1 TGF-beta activated kinase 1 (MAP3K7) binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | TAB1 |
Synonyms | 3'-Tab1; MAP3K7IP1 |
Gene ID | 10454 |
mRNA Refseq | NM_006116.3 |
Protein Refseq | NP_006107.1 |
MIM | 602615 |
UniProt ID | Q15750 |
◆ Recombinant Proteins | ||
TAB1-8951M | Recombinant Mouse TAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAB1-30837TH | Recombinant Human TAB1, His-tagged | +Inquiry |
Tab1-6268M | Recombinant Mouse Tab1 Protein, Myc/DDK-tagged | +Inquiry |
TAB1-2151H | Recombinant Human TAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAB1-16366M | Recombinant Mouse TAB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAB1-1292HCL | Recombinant Human TAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAB1 Products
Required fields are marked with *
My Review for All TAB1 Products
Required fields are marked with *
0
Inquiry Basket