Recombinant Human TAB1 protein, T7/His-tagged

Cat.No. : TAB1-157H
Product Overview : Recombinant human TAB1 cDNA (504aa, Isoform-I, which derived from BC050554) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 504 a.a.
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESH PPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESID DALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDG LQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEI HGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGE RARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAH SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE QSVVTAP
Purity : >90% by SDS-PAGE
Applications : 1. May be used as TAB1 protein-protein interaction assay.2. As specific substrate protein for kinasw and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. Potential biomarker protein for various cancer diagnoses.4. As antigen for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name TAB1 TGF-beta activated kinase 1/MAP3K7 binding protein 1 [ Homo sapiens ]
Official Symbol TAB1
Synonyms TAB1; TAK1 binding protein 1; TAK1-binding protein 1; 3-Tab1; MAP3K7IP1; MGC57664;
Gene ID 10454
mRNA Refseq NM_006116
Protein Refseq NP_006107
MIM 602615
UniProt ID Q15750
Chromosome Location 22q13.1
Pathway Activated TLR4 signalling, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IL1-mediated signaling events, organism-specific biosystem; IRAK2 mediated activation of TAK1 complex, organism-specific biosystem; IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation, organism-specific biosystem;
Function catalytic activity; enzyme activator activity; kinase activator activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAB1 Products

Required fields are marked with *

My Review for All TAB1 Products

Required fields are marked with *

0
cart-icon