Recombinant Human TAB1 protein, T7/His-tagged
Cat.No. : | TAB1-157H |
Product Overview : | Recombinant human TAB1 cDNA (504aa, Isoform-I, which derived from BC050554) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 504 a.a. |
Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESH PPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESID DALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDG LQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEI HGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGE RARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAH SASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGE QSVVTAP |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used as TAB1 protein-protein interaction assay.2. As specific substrate protein for kinasw and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. Potential biomarker protein for various cancer diagnoses.4. As antigen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | TAB1 TGF-beta activated kinase 1/MAP3K7 binding protein 1 [ Homo sapiens ] |
Official Symbol | TAB1 |
Synonyms | TAB1; TAK1 binding protein 1; TAK1-binding protein 1; 3-Tab1; MAP3K7IP1; MGC57664; |
Gene ID | 10454 |
mRNA Refseq | NM_006116 |
Protein Refseq | NP_006107 |
MIM | 602615 |
UniProt ID | Q15750 |
Chromosome Location | 22q13.1 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IL1-mediated signaling events, organism-specific biosystem; IRAK2 mediated activation of TAK1 complex, organism-specific biosystem; IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation, organism-specific biosystem; |
Function | catalytic activity; enzyme activator activity; kinase activator activity; protein binding; |
◆ Recombinant Proteins | ||
TAB1-2151H | Recombinant Human TAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAB1-1772HFL | Recombinant Full Length Human TAB1 Protein, C-Flag-tagged | +Inquiry |
TAB1-16366M | Recombinant Mouse TAB1 Protein | +Inquiry |
TAB1-4597R | Recombinant Rhesus monkey TAB1 Protein, His-tagged | +Inquiry |
TAB1-1387C | Recombinant Chicken TAB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAB1-1292HCL | Recombinant Human TAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAB1 Products
Required fields are marked with *
My Review for All TAB1 Products
Required fields are marked with *