"TAF7" Related Products

Expand
Expand

Recombinant Human TAF7, His-tagged

Cat.No.: TAF7-30937TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-349 of Human TAF7 with N terminal His tag, 61.7kDa.
Description: The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 76 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLK DRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLK TIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDP KASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKK KYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAEN QGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSED EDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQE NEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMK VENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLE K
Gene Name: TAF7 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa [ Homo sapiens ]
Official Symbol: TAF7
Synonyms: TAF7; TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa; TAF2F, TATA box binding protein (TBP) associated factor, RNA polymerase II, F, 55kD; transcription initiation factor TFIID subunit 7; TAFII55;
Gene ID: 6879
mRNA Refseq: NM_005642
Protein Refseq: NP_005633
MIM: 600573
Uniprot ID: Q15545
Chromosome Location: 5q31
Pathway: Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem;
Function: histone acetyltransferase binding; protein binding; contributes_to sequence-specific DNA binding transcription factor activity; thyroid hormone receptor binding; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.