Recombinant Human TARS2, His-tagged
Cat.No. : | TARS2-30152TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 172-371 of Human TARS2, with N terminal His tag, 200 amino acids, MWt 23kDa, |
- Specification
- Gene Information
- Related Products
Description : | TARS2 is a Threonyl-tRNA synthetase, catalysingthe reaction: ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKD NPFKLHLIEEKVTGPTATVYGCGTLVDLCQGPHLRHTG QIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTTELLRV WEAWREEAELRDHRRIGKEQELFFFHELSPGSCFFLPR GTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTKLWEQSGH WEHY |
Gene Name : | TARS2 threonyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ] |
Official Symbol : | TARS2 |
Synonyms : | TARS2; threonyl-tRNA synthetase 2, mitochondrial (putative); TARSL1, threonyl tRNA synthetase like 1; threonyl-tRNA synthetase, mitochondrial; FLJ12528; threonine tRNA ligase 2; mitochondrial; |
Gene ID : | 80222 |
mRNA Refseq : | NM_025150 |
Protein Refseq : | NP_079426 |
MIM : | 612805 |
Uniprot ID : | Q9BW92 |
Chromosome Location : | 1q21.2 |
Pathway : | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Gene Expression, organism-specific biosystem; |
Function : | ATP binding; ligase activity; molecular_function; nucleotide binding; threonine-tRNA ligase activity; |
Products Types
◆ Recombinant Protein | ||
Tars2-2112M | Recombinant Mouse Tars2 Protein, His-tagged | +Inquiry |
TARS2-824H | Recombinant Human TARS2 Protein (369-718 aa), His-SUMO-tagged | +Inquiry |
TARS2-8991M | Recombinant Mouse TARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TARS2-5589R | Recombinant Rat TARS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tars2-2113R | Recombinant Rat Tars2 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
TARS2-1250HCL | Recombinant Human TARS2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket