Recombinant Human TARS2, His-tagged
Cat.No. : | TARS2-30152TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 172-371 of Human TARS2, with N terminal His tag, 200 amino acids, MWt 23kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 172-371 a.a. |
Description : | TARS2 is a Threonyl-tRNA synthetase, catalysingthe reaction: ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKD NPFKLHLIEEKVTGPTATVYGCGTLVDLCQGPHLRHTG QIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTTELLRV WEAWREEAELRDHRRIGKEQELFFFHELSPGSCFFLPR GTRVYNALVAFIRAEYAHRGFSEVKTPTLFSTKLWEQSGH WEHY |
Gene Name | TARS2 threonyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ] |
Official Symbol | TARS2 |
Synonyms | TARS2; threonyl-tRNA synthetase 2, mitochondrial (putative); TARSL1, threonyl tRNA synthetase like 1; threonyl-tRNA synthetase, mitochondrial; FLJ12528; threonine tRNA ligase 2; mitochondrial; |
Gene ID | 80222 |
mRNA Refseq | NM_025150 |
Protein Refseq | NP_079426 |
MIM | 612805 |
Uniprot ID | Q9BW92 |
Chromosome Location | 1q21.2 |
Pathway | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Gene Expression, organism-specific biosystem; |
Function | ATP binding; ligase activity; molecular_function; nucleotide binding; threonine-tRNA ligase activity; |
◆ Recombinant Proteins | ||
TARS2-5930R | Recombinant Rat TARS2 Protein | +Inquiry |
Tars2-2113R | Recombinant Rat Tars2 Protein, His-tagged | +Inquiry |
TARS2-824H | Recombinant Human TARS2 Protein (369-718 aa), His-SUMO-tagged | +Inquiry |
TARS2-30152TH | Recombinant Human TARS2, His-tagged | +Inquiry |
TARS2-2750H | Recombinant Human TARS2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TARS2-1250HCL | Recombinant Human TARS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TARS2 Products
Required fields are marked with *
My Review for All TARS2 Products
Required fields are marked with *
0
Inquiry Basket