"TCF3" Related Products

Expand

Recombinant Human TCF3

Cat.No.: TCF3-29462TH
Product Overview: Recombinant fragment corresponding to amino acids 545-654 of Human TCF3 / E2A with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description: This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEK PQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEE KVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name: TCF3 transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) [ Homo sapiens ]
Official Symbol: TCF3
Synonyms: TCF3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor E2-alpha; bHLHb21; E2A; E2A immunoglobulin enhancer binding factor E12/E47; E47; immunoglobulin transcription factor 1; ITF1; kappa E2 binding factor;
Gene ID: 6929
mRNA Refseq: NM_001136139
Protein Refseq: NP_001129611
MIM: 147141
Uniprot ID: P15923
Chromosome Location: 19p13.3
Pathway: CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: DNA binding; contributes_to DNA binding; DNA binding; E-box binding; contributes_to E-box binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.