Recombinant Human TCF3
Cat.No. : | TCF3-29462TH |
Product Overview : | Recombinant fragment corresponding to amino acids 545-654 of Human TCF3 / E2A with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEK PQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEE KVSGVVGDPQMVLSAPHPGLSEAHNPAGHM |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | TCF3 transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) [ Homo sapiens ] |
Official Symbol | TCF3 |
Synonyms | TCF3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor E2-alpha; bHLHb21; E2A; E2A immunoglobulin enhancer binding factor E12/E47; E47; immunoglobulin transcription factor 1; ITF1; kappa E2 binding factor; |
Gene ID | 6929 |
mRNA Refseq | NM_001136139 |
Protein Refseq | NP_001129611 |
MIM | 147141 |
Uniprot ID | P15923 |
Chromosome Location | 19p13.3 |
Pathway | CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | DNA binding; contributes_to DNA binding; DNA binding; E-box binding; contributes_to E-box binding; |
◆ Recombinant Proteins | ||
Tcf3-6339M | Recombinant Mouse Tcf3 Protein, Myc/DDK-tagged | +Inquiry |
Tcf3-2118M | Recombinant Mouse Tcf3 Protein, His-tagged | +Inquiry |
TCF3-32H | Recombinant Human TCF3 protein, His-tagged | +Inquiry |
TCF3-28HFL | Recombinant Full Length Human TCF3 Protein, C-Myc/DDK-tagged | +Inquiry |
TCF3-581H | Recombinant Human TCF3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCF3-1180HCL | Recombinant Human TCF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCF3 Products
Required fields are marked with *
My Review for All TCF3 Products
Required fields are marked with *
0
Inquiry Basket