Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TCF3

Cat.No. : TCF3-29462TH
Product Overview : Recombinant fragment corresponding to amino acids 545-654 of Human TCF3 / E2A with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEK PQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEE KVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name : TCF3 transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) [ Homo sapiens ]
Official Symbol : TCF3
Synonyms : TCF3; transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47); transcription factor E2-alpha; bHLHb21; E2A; E2A immunoglobulin enhancer binding factor E12/E47; E47; immunoglobulin transcription factor 1; ITF1; kappa E2 binding factor;
Gene ID : 6929
mRNA Refseq : NM_001136139
Protein Refseq : NP_001129611
MIM : 147141
Uniprot ID : P15923
Chromosome Location : 19p13.3
Pathway : CDO in myogenesis, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function : DNA binding; contributes_to DNA binding; DNA binding; E-box binding; contributes_to E-box binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends