"TCP11" Related Products

Expand

Recombinant Human TCP11

Cat.No.: TCP11-27007TH
Product Overview: Recombinant fragment of Human TCP11, isoform 2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: T-complex protein 11 homolog is a protein that in humans is encoded by the TCP11 gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed only in fertile adult testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV
Sequence Similarities: Belongs to the TCP11 family.
Gene Name: TCP11 t-complex 11 homolog (mouse) [ Homo sapiens ]
Official Symbol: TCP11
Synonyms: TCP11; t-complex 11 homolog (mouse); D6S230E, t complex 11 (a murine tcp homolog); T-complex protein 11 homolog; KIAA0229;
Gene ID: 6954
mRNA Refseq: NM_001093728
Protein Refseq: NP_001087197
MIM: 186982
Uniprot ID: Q8WWU5
Chromosome Location: 6p21.31

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.