"TFAM" Related Products

Expand

Recombinant Human TFAM, His-tagged

Cat.No.: TFAM-30255TH
Product Overview: Recombinant full length Human mtTFA with N terminal His tag; 225 amino acids with tag, MWt 26.6 kDa inclusive of tag.
Description: This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Protein length: 204 amino acids
Conjugation: HIS
Molecular Weight: 26.600kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Sequence Similarities: Contains 2 HMG box DNA-binding domains.
Gene Name: TFAM transcription factor A, mitochondrial [ Homo sapiens ]
Official Symbol: TFAM
Synonyms: TFAM; transcription factor A, mitochondrial; TCF6, TCF6L2;
Gene ID: 7019
mRNA Refseq: NM_003201
Protein Refseq: NP_003192
MIM: 600438
Uniprot ID: Q00059
Chromosome Location: 10q21
Pathway: Energy Metabolism, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem; Mitochondrial transcription initiation, organism-specific biosystem;
Function: DNA binding; chromatin binding; mitochondrial light strand promoter sense binding; protein binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.