Native Human TGFA

PRODUCTS

Home / Products / Native Human TGFA

Native Human TGFA

TGFA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TGFA-29704TH
Product Overview : Human TGF alpha.
Description : This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source : E. coli
Tissue specificity : Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Form : Liquid
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA
Sequence Similarities : Contains 1 EGF-like domain.
Gene Name : TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol : TGFA
Synonyms : TGFA; transforming growth factor, alpha; protransforming growth factor alpha;
Gene ID : 7039
mRNA Refseq : NM_001099691
Protein Refseq : NP_001093161
MIM : 190170
Uniprot ID : P01135
Chromosome Location : 2p13
Pathway : Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem;
Function : MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.