"TGFA" Related Products

Expand
Expand
Expand

Native Human TGFA

Cat.No.: TGFA-29704TH
Product Overview: Human TGF alpha.
Description: This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Source: E. coli
Tissue specificity: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
Form: Liquid
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Recombinant Human TGF-a is a 5.5 kDa protein containing 50 amino acid residues:VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHA DLLA
Sequence Similarities: Contains 1 EGF-like domain.
Gene Name: TGFA transforming growth factor, alpha [ Homo sapiens ]
Official Symbol: TGFA
Synonyms: TGFA; transforming growth factor, alpha; protransforming growth factor alpha;
Gene ID: 7039
mRNA Refseq: NM_001099691
Protein Refseq: NP_001093161
MIM: 190170
Uniprot ID: P01135
Chromosome Location: 2p13
Pathway: Direct p53 effectors, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, conserved biosystem;
Function: MAP kinase kinase activity; epidermal growth factor receptor binding; glycoprotein binding; growth factor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.