"TGFB2" Related Products

Expand

Recombinant Human TGFB2

Cat.No.: TGFB2-31244TH
Product Overview: Recombinant full length protein (Human) expressed using (BTI-Tn-5B1-4) cells
Description: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers. The encoded protein is secreted and has suppressive effects of interleukin-2 dependent T-cell growth. Translocation t(1;7)(q41;p21) between this gene and HDAC9 is associated with Peters anomaly, a congenital defect of the anterior chamber of the eye. The knockout mice lacking this gene show perinatal mortality and a wide range of developmental, including cardiac, defects. Alternatively spliced transcript variants encoding different isoforms have been identified.
Form: Lyophilised:Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1- 1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer conta
Purity: >95% by SDS-PAGE
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: hTGF-b2 (Human Transforming Growth Factor beta 2) is a 25.0 kDa protein with each subunit containing 112 amino acid residues:ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAG ACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDL EPLTILYYIGKTPKIEQLSNMIVKSCKCS
Sequence Similarities: Belongs to the TGF-beta family.
Gene Name: TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
Official Symbol: TGFB2
Synonyms: TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2;
Gene ID: 7042
mRNA Refseq: NM_001135599
Protein Refseq: NP_001129071
MIM: 190220
Uniprot ID: P61812
Chromosome Location: 1q41
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem;
Function: beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.