Recombinant Human TIAM2, His-tagged TIAM2-30624TH

Recombinant Human TIAM2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TIAM2, His-tagged

Recombinant Human TIAM2, His-tagged

TIAM2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TIAM2-30624TH
Product Overview : Recombinant fragment, corresponding to amino acids 1134-1701 of Human TIAM2 with N terminal His tag, 568 amino acids, 80kDa,
Description : This gene encodes a guanine nucleotide exchange factor. A highly similar mouse protein specifically activates ras-related C3 botulinum substrate 1, converting this Rho-like guanosine triphosphatase (GTPase) from a guanosine diphosphate-bound inactive state to a guanosine triphosphate-bound active state. The encoded protein may play a role in neural cell development. Alternatively spliced transcript variants encoding different isoforms have been described.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in the occipital, frontal and temporal lobes, cerebellum, putamen and testis.
Form : Lyophilised:Reconstitution with 153 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNT LETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKV QKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQR VLKYPLLLKELVSLTDQESEEHYHLTEALKAMEKVASH INEMQKIYEDYGTVFDQLVAEQSGTEKEVTELSMGELLMH STVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENC KLKKKLPSNSRPAHNSTDLDPFKFRWLIPISALQVRLGNP AGTENNSIWELIHTKSEIEGRPETIFQLCCSDSESKTN IVKVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPV SAKLASSRSLKVLKNSSSNEWTGETGKGTLLDSDEGSL SSGTQSSGCPTAEGRQDSKSTSPGKYPHPGLADFADNL IKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDP DVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKA NSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFS VQSLTSVVSEECFYETESHGKS
Sequence Similarities : Belongs to the TIAM family.Contains 1 DH (DBL-homology) domain.Contains 1 PDZ (DHR) domain.Contains 2 PH domains.Contains 1 RBD (Ras-binding) domain.
Gene Name : TIAM2 T-cell lymphoma invasion and metastasis 2 [ Homo sapiens ]
Official Symbol : TIAM2
Synonyms : TIAM2; T-cell lymphoma invasion and metastasis 2; T-lymphoma invasion and metastasis-inducing protein 2; STEF;
Gene ID : 26230
mRNA Refseq : NM_001010927
Protein Refseq : NP_001010927
MIM : 604709
Uniprot ID : Q8IVF5
Chromosome Location : 6q25
Pathway : Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem;
Function : Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; receptor signaling protein activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy