"TK1" Related Products

Expand
Expand

Recombinant Human TK1, His-tagged

Cat.No.: TK1-31518TH
Product Overview: Recombinant full length Human Thymidine Kinase 1 protein with an N terminal His tag. Predicted MWt: 27 kDa;
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRV RRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPA CLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMEC FREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKAS GQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Sequence Similarities: Belongs to the thymidine kinase family.
Gene Name: TK1 thymidine kinase 1, soluble [ Homo sapiens ]
Official Symbol: TK1
Synonyms: TK1; thymidine kinase 1, soluble; thymidine kinase, cytosolic;
Gene ID: 7083
mRNA Refseq: NM_003258
Protein Refseq: NP_003249
MIM: 188300
Uniprot ID: P04183
Chromosome Location: 17q23.2-q25.3
Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function: ATP binding; kinase activity; metal ion binding; nucleoside kinase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.