Recombinant Human TK1, His-tagged
Cat.No. : | TK1-31518TH |
Product Overview : | Recombinant full length Human Thymidine Kinase 1 protein with an N terminal His tag. Predicted MWt: 27 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRV RRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPA CLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMEC FREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKAS GQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN |
Sequence Similarities : | Belongs to the thymidine kinase family. |
Full Length : | Full L. |
Gene Name | TK1 thymidine kinase 1, soluble [ Homo sapiens ] |
Official Symbol | TK1 |
Synonyms | TK1; thymidine kinase 1, soluble; thymidine kinase, cytosolic; |
Gene ID | 7083 |
mRNA Refseq | NM_003258 |
Protein Refseq | NP_003249 |
MIM | 188300 |
Uniprot ID | P04183 |
Chromosome Location | 17q23.2-q25.3 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
Function | ATP binding; kinase activity; metal ion binding; nucleoside kinase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
TK1-08H | Active Recombinant Human TK1 Protein, His-tagged | +Inquiry |
TK1-10208Z | Recombinant Zebrafish TK1 | +Inquiry |
TK1-6460C | Recombinant Chicken TK1 | +Inquiry |
TK1-9H | Recombinant Human TK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TK1-6460H | Recombinant Human TK1 Protein (Met1-Asn234), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TK1-1783HCL | Recombinant Human TK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TK1 Products
Required fields are marked with *
My Review for All TK1 Products
Required fields are marked with *