"TLR2" Related Products

Expand
Expand
Expand

Recombinant Human TLR2 protein, GST-tagged

Cat.No.: TLR2-30423TH
Product Overview: Recombinant Human TLR2(201 a.a. - 300 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: SHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TLR2 toll-like receptor 2 [ Homo sapiens ]
Official Symbol: TLR2
Synonyms: TLR2; toll-like receptor 2; CD282; TIL4; toll/interleukin 1 receptor-like 4; toll/interleukin-1 receptor-like protein 4;
Gene ID: 7097
mRNA Refseq: NM_003264
Protein Refseq: NP_003255
MIM: 603028
UniProt ID: O60603
Chromosome Location: 4q32
Pathway: Activated TLR4 signalling, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Beta defensins, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Defensins, organism-specific biosystem;
Function: Gram-positive bacterial cell surface binding; lipopolysaccharide receptor activity; pattern recognition receptor activity; peptidoglycan binding; protein binding; protein heterodimerization activity; receptor activity; transmembrane signaling receptor activity; triacyl lipopeptide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.