"TMOD3" Related Products

Expand

Recombinant Human TMOD3, His-tagged

Cat.No.: TMOD3-31625TH
Product Overview: Recombinant fragment, corresponding to amino acids 81-263 of Human Tropomodulin 3 with an N-terminal His tag; MWt 21 kDa.
Description: Tropomodulin-3 is a protein that in humans is encoded by the TMOD3 gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 116 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELE EALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNG VDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKEN DAHLVEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSL AATRSNDPVATAFAEMLKVNKTLKSLNVE
Sequence Similarities: Belongs to the tropomodulin family.
Gene Name: TMOD3 tropomodulin 3 (ubiquitous) [ Homo sapiens ]
Official Symbol: TMOD3
Synonyms: TMOD3; tropomodulin 3 (ubiquitous); tropomodulin-3; UTMOD;
Gene ID: 29766
mRNA Refseq: NM_014547
Protein Refseq: NP_055362
MIM: 605112
Uniprot ID: Q9NYL9
Chromosome Location: 15q21.1-q21.2
Function: actin binding; tropomyosin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.