Recombinant Human TNC

• Cat.No.: TNC-31215TH
• Product Overview: Recombinant fragment corresponding to amino acids 181-290 of Human Tenascin C with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Description: This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLA CPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEH GTCVDGLCVCHDGFAGDDCNKPLCLNNCYN
• Sequence Similarities: Belongs to the tenascin family.Contains 15 EGF-like domains.Contains 1 fibrinogen C-terminal domain.Contains 15 fibronectin type-III domains.

Gene Information

• Gene Name: TNC tenascin C [ Homo sapiens ]
• Official Symbol: TNC
• Synonyms: TNC; tenascin C; hexabrachion (tenascin C, cytotactin) , HXB; tenascin; hexabrachion (tenascin); MGC167029; TN
• Gene ID: 3371
• mRNA Refseq: NM_002160
• Protein Refseq: NP_002151
• MIM: 187380
• Uniprot ID: P24821
• Chromosome Location: 9q32-q34
• Pathway: ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: binding; receptor binding; syndecan binding