Recombinant Human TNFRSF4, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TNFRSF4, Fc-tagged

Recombinant Human TNFRSF4, Fc-tagged

TNFRSF4 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TNFRSF4-27215TH
Product Overview : Recombinant fragment corresponding to amino acids 26-207 of Human CD134 / OX40 , fused to the Fc region of Human IgG1 expressed in modified Human 293 cells, 55 and 65 kDa.
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
Conjugation : Fc
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : Theoretical sequence:LHCVGDTYPSNDRCCHECRPGNGMVSRCS RSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSER KQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSP GDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPA TQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVGIPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
Sequence Similarities : Contains 4 TNFR-Cys repeats.
Gene Name : TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
Official Symbol : TNFRSF4
Synonyms : TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40;
Gene ID : 7293
mRNA Refseq : NM_003327
Protein Refseq : NP_003318
MIM : 600315
Uniprot ID : P43489
Chromosome Location : 1p36
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem;
Function : binding; receptor activity; tumor necrosis factor-activated receptor activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.