"TNFRSF4" Related Products

Expand
Expand
Expand

Recombinant Human TNFRSF4, Fc-tagged

Cat.No.: TNFRSF4-27215TH
Product Overview: Recombinant fragment corresponding to amino acids 26-207 of Human CD134 / OX40 , fused to the Fc region of Human IgG1 expressed in modified Human 293 cells, 55 and 65 kDa.
Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
Conjugation: Fc
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: Theoretical sequence:LHCVGDTYPSNDRCCHECRPGNGMVSRCS RSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSER KQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSP GDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPA TQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVGIPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
Sequence Similarities: Contains 4 TNFR-Cys repeats.
Gene Name: TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
Official Symbol: TNFRSF4
Synonyms: TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40;
Gene ID: 7293
mRNA Refseq: NM_003327
Protein Refseq: NP_003318
MIM: 600315
Uniprot ID: P43489
Chromosome Location: 1p36
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem;
Function: binding; receptor activity; tumor necrosis factor-activated receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.