"TNFSF4" Related Products

Expand
Expand
Expand

Recombinant Human TNFSF4

Cat.No.: TNFSF4-27254TH
Product Overview: Recombinant Human TNFSF4 was expressed in Hi-5 Insect cells.
Description: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Source: Hi-5 Insect cells
Species: Human
Bio-activity: Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors.
Molecular Mass: 15 kDa
AA Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEP LFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration: Resuspend the protein in the desired concentration in proper buffer
Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Gene Name: TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ]
Official Symbol: TNFSF4
Synonyms: TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L
Gene ID: 7292
mRNA Refseq: NM_003326
Protein Refseq: NP_003317
MIM: 603594
UniProt ID: P23510
Chromosome Location: 1q25
Pathway: Cytokine-cytokine receptor interaction; TSLP Signaling Pathway
Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding; tumor necrosis factor receptor superfamily binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.