"TPR" Related Products

Recombinant Human TPR, His-tagged

Cat.No.: TPR-30424TH
Product Overview: Recombinant fragment, corresponding to amino acids 69-668 of Human TPR with N terminal His tag. MWt: 69 kDa;
Description: This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5 end of this gene with several different kinase genes occur in some neoplasias.
Conjugation: HIS
Source: E. coli
Tissue specificity: Highest in testis, lung, thymus, spleen and brain, lower levels in heart, liver and kidney.
Form: Lyophilised:Reconstitute with 103 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VNETRECQSLRLELEKLNNQLKALTEKNKELEIAQDRNIA IQSQFTRTKEELEAEKRDLIRTNERLSQELEYLTEDVK RLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLE QEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKC NLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLK EAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKS NELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEK EMLEKIGRLEKELENANDLLSATKRKGAILSEEELAAM SPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLEN KRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSV KLEQAMKEIQRLQEDTDKANKQSSVLERDNRRMEIQVK DLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEV ISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELEQLRKSRQHQMQLVDSIVRQ RDMYRILLSQTTGVAIPLHASSLDDVSLASTPKRPSTS QTVSTPAPVPVIESTEAIEA(Amino acid sequence (Sequence determined by 5 Sequencing))
Gene Name: TPR translocated promoter region (to activated MET oncogene) [ Homo sapiens ]
Official Symbol: TPR
Synonyms: TPR; translocated promoter region (to activated MET oncogene); nucleoprotein TPR;
Gene ID: 7175
mRNA Refseq: NM_003292
Protein Refseq: NP_003283
MIM: 189940
Uniprot ID: P12270
Chromosome Location: 1q25
Pathway: Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function: ATP binding; nucleotide binding; protein binding; serine-tRNA ligase activity;
Products Types ◆ Recombinant Protein

Related Gene
TPR

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.