Recombinant Full Length Human UCK2, C His-tagged

• Cat.No.: UCK2-30101TH
• Product Overview: Recombinant full length Human UCK2 (amino acids 1-261) with C terminal His tag; 269 amino acids with tag, MWt 30.3 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-261 a.a.
• Description: This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.
• Conjugation: HIS
• Molecular Weight: 30.300kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 1mM EDTA, 0.1mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPHLEHHHHHH

Gene Information

• Gene Name: UCK2 uridine-cytidine kinase 2 [ Homo sapiens ]
• Official Symbol: UCK2
• Synonyms: UCK2; uridine-cytidine kinase 2; UMPK, uridine monophosphate kinase
• Gene ID: 7371
• mRNA Refseq: NM_012474
• Protein Refseq: NP_036606
• MIM: 609329
• Uniprot ID: Q9BZX2
• Chromosome Location: 1p32
• Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: ATP binding; kinase activity; nucleoside kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor