"UCK2" Related Products

Recombinant Human UCK2, His-tagged

Cat.No.: UCK2-30101TH
Product Overview: Recombinant full length Human UCK2 (amino acids 1-261) with C terminal His tag; 269 amino acids with tag, MWt 30.3 kDa.
Description: This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively.
Protein length: 261 amino acids
Conjugation: HIS
Molecular Weight: 30.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 1mM EDTA, 0.1mM PMSF, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPHLEHHHHHH
Gene Name: UCK2 uridine-cytidine kinase 2 [ Homo sapiens ]
Official Symbol: UCK2
Synonyms: UCK2; uridine-cytidine kinase 2; UMPK, uridine monophosphate kinase;
Gene ID: 7371
mRNA Refseq: NM_012474
Protein Refseq: NP_036606
MIM: 609329
Uniprot ID: Q9BZX2
Chromosome Location: 1p32
Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function: ATP binding; kinase activity; nucleoside kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.