Recombinant Human UPF1, His-tagged

• Cat.No.: UPF1-30951TH
• Product Overview: Recombinant fragment, corresponding to amino acids 703-1118 of Human RENT1/hUPF1 with N terminal His tag; 416 amino acids, 67 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 703-1118 a.a.
• Description: This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene.
• Conjugation: HIS
• Tissue specificity: Ubiquitous.
• Form: Lyophilised:Reconstitute with 69 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQP DKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKL LKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLY QEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQK VLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAM YDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAG PSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPK GKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFS QGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFK SQIDVALSQDSTYQGERAYQHGGVTGLSQY
• Sequence Similarities: Belongs to the DNA2/NAM7 helicase family.Contains 1 C2H2-type zinc finger.

Gene Information

• Gene Name: UPF1 UPF1 regulator of nonsense transcripts homolog (yeast) [ Homo sapiens ]
• Official Symbol: UPF1
• Synonyms: UPF1; UPF1 regulator of nonsense transcripts homolog (yeast); regulator of nonsense transcripts 1 , RENT1; regulator of nonsense transcripts 1; HUPF1; KIAA0221; NORF1; pNORF1; smg 2; smg 2 homolog; nonsense mediated mRNA decay factor (C. elegans); UP Fram
• Gene ID: 5976
• mRNA Refseq: NM_002911
• Protein Refseq: NP_002902
• MIM: 601430
• Uniprot ID: Q92900
• Chromosome Location: 19p13.2-p13.11
• Pathway: Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem
• Function: ATP binding; ATP-dependent RNA helicase activity; DNA binding; RNA binding; chromatin binding