"UPF1" Related Products

Recombinant Human UPF1, His-tagged

Cat.No.: UPF1-30951TH
Product Overview: Recombinant fragment, corresponding to amino acids 703-1118 of Human RENT1/hUPF1 with N terminal His tag; 416 amino acids, 67 kDa ;
Description: This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 69 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQP DKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKL LKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLY QEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQK VLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAM YDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAG PSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPK GKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFS QGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFK SQIDVALSQDSTYQGERAYQHGGVTGLSQY
Sequence Similarities: Belongs to the DNA2/NAM7 helicase family.Contains 1 C2H2-type zinc finger.
Gene Name: UPF1 UPF1 regulator of nonsense transcripts homolog (yeast) [ Homo sapiens ]
Official Symbol: UPF1
Synonyms: UPF1; UPF1 regulator of nonsense transcripts homolog (yeast); regulator of nonsense transcripts 1 , RENT1; regulator of nonsense transcripts 1; HUPF1; KIAA0221; NORF1; pNORF1; smg 2; smg 2 homolog; nonsense mediated mRNA decay factor (C. elegans); UP Fram
Gene ID: 5976
mRNA Refseq: NM_002911
Protein Refseq: NP_002902
MIM: 601430
Uniprot ID: Q92900
Chromosome Location: 19p13.2-p13.11
Pathway: Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem;
Function: ATP binding; ATP-dependent RNA helicase activity; DNA binding; RNA binding; chromatin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.