"VAPA" Related Products

Expand

Recombinant Human VAPA, His-tagged

Cat.No.: VAPA-30991TH
Product Overview: Recombinant fragment of Human VAPA with a 37aa N terminal His tag; 264aa, 29.8 kDa.
Description: The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Protein length: 227 amino acids
Conjugation: HIS
Molecular Weight: 29.800kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris, 0.02% DTT, 10% Glycerol
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMASA SGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSD RKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFD YDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDS KLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHS VSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLR KVAHSDKPGSTSTASFRDNVTSP
Sequence Similarities: Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family.Contains 1 MSP domain.
Gene Name: VAPA VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa [ Homo sapiens ]
Official Symbol: VAPA
Synonyms: VAPA; VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa; VAMP (vesicle associated membrane protein) associated protein A (33kD); vesicle-associated membrane protein-associated protein A; hVAP 33; VAP A;
Gene ID: 9218
mRNA Refseq: NM_003574
Protein Refseq: NP_003565
MIM: 605703
Uniprot ID: Q9P0L0
Chromosome Location: 18p11.2
Pathway: Diurnally regulated genes with circadian orthologs, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Tight junction, organism-specific biosystem; Tight junction, conserved biosystem;
Function: protein binding; protein heterodimerization activity; signal transducer activity; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.