Recombinant Human VAPA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : VAPA-3282H
Product Overview : VAPA MS Standard C13 and N15-labeled recombinant protein (NP_003565) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Molecular Mass : 32.4 kDa
AA Sequence : MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name VAPA VAMP associated protein A [ Homo sapiens (human) ]
Official Symbol VAPA
Synonyms VAPA; VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa; VAMP (vesicle associated membrane protein) associated protein A (33kD); vesicle-associated membrane protein-associated protein A; hVAP 33; VAP A; VAMP-A; VAMP-associated protein A; 33 kDa VAMP-associated protein; VAP-A; VAP33; VAP-33; hVAP-33; MGC3745;
Gene ID 9218
mRNA Refseq NM_003574
Protein Refseq NP_003565
MIM 605703
UniProt ID Q9P0L0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VAPA Products

Required fields are marked with *

My Review for All VAPA Products

Required fields are marked with *

0
cart-icon
0
compare icon