"VAT1L" Related Products

Recombinant Human VAT1L, His-tagged

Cat.No.: VAT1L-26701TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-419 of Human KIAA1576 with N terminal His tag; Predicted MWt 47 kDa.
Description: KIAA1576 belongs to the zinc-containing alcohol dehydrogenase family; Quinone oxidoreductase subfamily.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 98 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQ EMRAVVLAGFGGLNKLRLFRKAMPEPQDGELKIRVKAC GLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDS VKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMS FSEAAAFPMNFVTAYVMLFEVANLREGMSVLVHSAGGGVG QAVAQLCSTVPNVTVFGTASTFKHEAIKDSVTHLFDRN ADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLG TYILYGSSNMVTGETKSFFSFAKSWWQVEKVNPIKLYE ENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKK IKPVVDSLWALEEVKEAMQRIHDRGNIGKLILDVEKTPTP LMANDSTETSEAGEEEEDHEGDSENKERMPFIQ
Sequence Similarities: Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
Gene Name: VAT1L vesicle amine transport protein 1 homolog (T. californica)-like [ Homo sapiens ]
Official Symbol: VAT1L
Synonyms: VAT1L; vesicle amine transport protein 1 homolog (T. californica)-like; synaptic vesicle membrane protein VAT-1 homolog-like; KIAA1576;
Gene ID: 57687
mRNA Refseq: NM_020927
Protein Refseq: NP_065978
Uniprot ID: Q9HCJ6
Chromosome Location: 16q23.1
Function: nucleotide binding; oxidoreductase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.