"VEGFA" Related Products

Native Human VEGFA

Cat.No.: VEGFA-31701TH
Product Overview: Human VEGF.
Description: This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.
Source: E. coli
Tissue specificity: Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
Form: Lyophilised:Reconstitute in 100ul dH2O
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Human VEGF is a 38.2 kDa protein consisting of two 165 amino acid polypeptide chains:APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYI FKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRI KPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPC SERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERT CRCDKPRR
Sequence Similarities: Belongs to the PDGF/VEGF growth factor family.
Gene Name: VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Official Symbol: VEGFA
Synonyms: VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor , VEGF; VEGF A; VPF;
Gene ID: 7422
mRNA Refseq: NM_001025366
Protein Refseq: NP_001020537
Uniprot ID: P15692
Chromosome Location: 6p12
Pathway: Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem;
Function: cell surface binding; chemoattractant activity; cytokine activity; cytokine activity; extracellular matrix binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.