"VPS11" Related Products

Recombinant Human VPS11, His-tagged

Cat.No.: VPS11-30026TH
Product Overview: Recombinant fragment, corresponding to amino acids 651-941 of Human VPS11 with an N terminal His tag. MW 36 kDa ;
Description: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 58 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQ QIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFA RKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTA TLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQE IQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQ HCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHD QFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLT SSLEAGLQRDLLMHSRRGT
Gene Name: VPS11 vacuolar protein sorting 11 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: VPS11
Synonyms: VPS11; vacuolar protein sorting 11 homolog (S. cerevisiae); vacuolar protein sorting 11 (yeast homolog); vacuolar protein sorting-associated protein 11 homolog; PEP5; RNF108;
Gene ID: 55823
mRNA Refseq: NM_021729
Protein Refseq: NP_068375
MIM: 608549
Uniprot ID: Q9H270
Chromosome Location: 11q23
Function: metal ion binding; nucleotide binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.