"VPS16" Related Products

Expand

Recombinant Human VPS16, His-tagged

Cat.No.: VPS16-31738TH
Product Overview: Recombinant fragment, corresponding to amino acids 334-839 of Human VPS16 with N terminal His tag; 506 amino acids, 59kDa.
Description: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 104 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREIQEL GQLTQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLD RFPPDSFVHMCQDLRVLNAVRDYHIGIPLTYSQYKQLT IQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWA CYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAY GCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKA IESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYR QFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEER IEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRLQR RLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRI PDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLPF VEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQA ADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK
Gene Name: VPS16 vacuolar protein sorting 16 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: VPS16
Synonyms: VPS16; vacuolar protein sorting 16 homolog (S. cerevisiae); vacuolar protein sorting-associated protein 16 homolog;
Gene ID: 64601
mRNA Refseq: NM_022575
Protein Refseq: NP_072097
MIM: 608550
Uniprot ID: Q9H269
Chromosome Location: 20p13
Function: actin filament binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.