"VRK1" Related Products

Expand
Expand
Expand

Recombinant Human VRK1, His-tagged

Cat.No.: VRK1-31740TH
Product Overview: Recombinant fragment, corresponding to amino acids 248-396 of Human VRK1 with an N terminal His tag. Predicted MWt 18 kDa:
Description: This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Highly expressed in fetal liver, testis and thymus.
Form: Lyophilised:Reconstitute with 82 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMD KCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILL QGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIE ESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Sequence Similarities: Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.Contains 1 protein kinase domain.
Gene Name: VRK1 vaccinia related kinase 1 [ Homo sapiens ]
Official Symbol: VRK1
Synonyms: VRK1; vaccinia related kinase 1; serine/threonine-protein kinase VRK1;
Gene ID: 7443
mRNA Refseq: NM_003384
Protein Refseq: NP_003375
MIM: 602168
Uniprot ID: Q99986
Chromosome Location: 14q32
Function: ATP binding; nucleotide binding; protein binding; protein serine/threonine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.