"WDR45L" Related Products

Recombinant Human WDR45L, His-tagged

Cat.No.: WDR45L-31542TH
Product Overview: Recombinant fragment, corresponding to amino acids 139-344 of Human WDR45L with N terminal His tag; 206 amino acids, 25kDa.
Description: This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers.
Form: Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: YNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPP VDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTS SGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHI FAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSG SPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDV YAQFLEMTDDKL
Sequence Similarities: Belongs to the WD repeat SVP1 family.Contains 2 WD repeats.
Gene Name: WDR45L WDR45-like [ Homo sapiens ]
Official Symbol: WDR45L
Synonyms: WDR45L; WDR45-like; WD repeat domain phosphoinositide-interacting protein 3; WIPI3;
Gene ID: 56270
mRNA Refseq: NM_019613
Protein Refseq: NP_062559
MIM: 609226
Uniprot ID: Q5MNZ6
Chromosome Location: 17q25.3
Function: phosphatidylinositol-3,5-bisphosphate binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.