Description : |
This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene. |
Conjugation : |
HIS |
Source : |
E. coli |
Tissue specificity : |
Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers. |
Form : |
Lyophilised:Reconstitute with 104 μl aqua dest. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
YNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPP VDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTS SGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHI FAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSG SPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDV YAQFLEMTDDKL |
Sequence Similarities : |
Belongs to the WD repeat SVP1 family.Contains 2 WD repeats. |