Recombinant Human WDR45L, His-tagged
Cat.No. : | WDR45L-31542TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 139-344 of Human WDR45L with N terminal His tag; 206 amino acids, 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers. |
Form : | Lyophilised:Reconstitute with 104 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPP VDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTS SGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHI FAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSG SPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDV YAQFLEMTDDKL |
Sequence Similarities : | Belongs to the WD repeat SVP1 family.Contains 2 WD repeats. |
Protein length : | 139-344 |
Gene Name : | WDR45L WDR45-like [ Homo sapiens ] |
Official Symbol : | WDR45L |
Synonyms : | WDR45L; WDR45-like; WD repeat domain phosphoinositide-interacting protein 3; WIPI3; |
Gene ID : | 56270 |
mRNA Refseq : | NM_019613 |
Protein Refseq : | NP_062559 |
MIM : | 609226 |
Uniprot ID : | Q5MNZ6 |
Chromosome Location : | 17q25.3 |
Function : | phosphatidylinositol-3,5-bisphosphate binding; |
Products Types
◆ Recombinant Protein | ||
WDR45L-3716H | Recombinant Human WDR45L, GST-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All WDR45L Products
Required fields are marked with *
My Review for All WDR45L Products
Required fields are marked with *
0
Inquiry Basket