Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Join NIH Research Festival Biotech Vendor Exhibits 2024 | Sep. 25th, 2024

Recombinant Human WDR45L, His-tagged

Cat.No. : WDR45L-31542TH
Product Overview : Recombinant fragment, corresponding to amino acids 139-344 of Human WDR45L with N terminal His tag; 206 amino acids, 25kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers.
Form : Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPP VDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTS SGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHI FAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSG SPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDV YAQFLEMTDDKL
Sequence Similarities : Belongs to the WD repeat SVP1 family.Contains 2 WD repeats.
Protein length : 139-344
Gene Name : WDR45L WDR45-like [ Homo sapiens ]
Official Symbol : WDR45L
Synonyms : WDR45L; WDR45-like; WD repeat domain phosphoinositide-interacting protein 3; WIPI3;
Gene ID : 56270
mRNA Refseq : NM_019613
Protein Refseq : NP_062559
MIM : 609226
Uniprot ID : Q5MNZ6
Chromosome Location : 17q25.3
Function : phosphatidylinositol-3,5-bisphosphate binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WDR45L Products

Required fields are marked with *

My Review for All WDR45L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends