"YY1" Related Products

Expand

Recombinant Human YY1

Cat.No.: YY1-31565TH
Product Overview: Recombinant fragment amino acids 221-320 of Human YY1 with a proprietary tag at N-terminal: predicted molecular weight 36.63 kDa.
Description: YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters.YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Sequence Similarities: Belongs to the YY transcription factor family.Contains 4 C2H2-type zinc fingers.
Gene Name: YY1 YY1 transcription factor [ Homo sapiens ]
Official Symbol: YY1
Synonyms: YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1;
Gene ID: 7528
mRNA Refseq: NM_003403
Protein Refseq: NP_003394
MIM: 600013
Uniprot ID: P25490
Chromosome Location: 14q
Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function: DNA binding; RNA binding; four-way junction DNA binding; metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.