Recombinant Human YY1
Cat.No. : | YY1-31565TH |
Product Overview : | Recombinant fragment amino acids 221-320 of Human YY1 with a proprietary tag at N-terminal: predicted molecular weight 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters.YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH |
Sequence Similarities : | Belongs to the YY transcription factor family.Contains 4 C2H2-type zinc fingers. |
Gene Name | YY1 YY1 transcription factor [ Homo sapiens ] |
Official Symbol | YY1 |
Synonyms | YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1; |
Gene ID | 7528 |
mRNA Refseq | NM_003403 |
Protein Refseq | NP_003394 |
MIM | 600013 |
Uniprot ID | P25490 |
Chromosome Location | 14q |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | DNA binding; RNA binding; four-way junction DNA binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
YY1-12HFL | Recombinant Full Length Human YY1 Protein, N-Flag-tagged | +Inquiry |
YY1-632H | Recombinant Human YY1 transcription factor, His-tagged | +Inquiry |
YY1-2674H | Recombinant Human YY1, His-tagged | +Inquiry |
YY1-2873C | Recombinant Chicken YY1 | +Inquiry |
YY1-599H | Recombinant Human YY1, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YY1-228HCL | Recombinant Human YY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YY1 Products
Required fields are marked with *
My Review for All YY1 Products
Required fields are marked with *
0
Inquiry Basket