"ZFP36" Related Products

Expand
Expand

Recombinant Human ZFP36

Cat.No.: ZFP36-31616TH
Product Overview: Recombinant full length Human Tristetraprolin (amino acids 1-326) with a proprietary tag at N-terminal: predicted molecular weight 61.93 kDa.
Description: Tristetraprolin (TTP) also known as zinc finger protein 36 homolog (ZFP36) is a protein that in humans is encoded by the ZFP36 gene.
Protein length: 326 amino acids
Molecular Weight: 61.930kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Sequence Similarities: Contains 2 C3H1-type zinc fingers.
Gene Name: ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ]
Official Symbol: ZFP36
Synonyms: ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP;
Gene ID: 7538
mRNA Refseq: NM_003407
Protein Refseq: NP_003398
MIM: 190700
Uniprot ID: P26651
Chromosome Location: 19q13.1
Pathway: Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Metabolism, organism-specific biosystem;
Function: AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.