Recombinant Human ZFP36
| Cat.No. : | ZFP36-31616TH |
| Product Overview : | Recombinant full length Human Tristetraprolin (amino acids 1-326) with a proprietary tag at N-terminal: predicted molecular weight 61.93 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 326 amino acids |
| Description : | Tristetraprolin (TTP) also known as zinc finger protein 36 homolog (ZFP36) is a protein that in humans is encoded by the ZFP36 gene. |
| Molecular Weight : | 61.930kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE |
| Sequence Similarities : | Contains 2 C3H1-type zinc fingers. |
| Gene Name | ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ] |
| Official Symbol | ZFP36 |
| Synonyms | ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP; |
| Gene ID | 7538 |
| mRNA Refseq | NM_003407 |
| Protein Refseq | NP_003398 |
| MIM | 190700 |
| Uniprot ID | P26651 |
| Chromosome Location | 19q13.1 |
| Pathway | Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Metabolism, organism-specific biosystem; |
| Function | AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| ZFP36-313H | Recombinant Human ZFP36 Protein, GST/His-tagged | +Inquiry |
| ZFP36-555HF | Recombinant Full Length Human ZFP36 Protein | +Inquiry |
| ZFP36-31616TH | Recombinant Human ZFP36 | +Inquiry |
| ZFP36-10345M | Recombinant Mouse ZFP36 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZFP36-18904M | Recombinant Mouse ZFP36 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZFP36 Products
Required fields are marked with *
My Review for All ZFP36 Products
Required fields are marked with *
