Recombinant Human ZFP36
Cat.No. : | ZFP36-31616TH |
Product Overview : | Recombinant full length Human Tristetraprolin (amino acids 1-326) with a proprietary tag at N-terminal: predicted molecular weight 61.93 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 326 amino acids |
Description : | Tristetraprolin (TTP) also known as zinc finger protein 36 homolog (ZFP36) is a protein that in humans is encoded by the ZFP36 gene. |
Molecular Weight : | 61.930kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE |
Sequence Similarities : | Contains 2 C3H1-type zinc fingers. |
Gene Name | ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ] |
Official Symbol | ZFP36 |
Synonyms | ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP; |
Gene ID | 7538 |
mRNA Refseq | NM_003407 |
Protein Refseq | NP_003398 |
MIM | 190700 |
Uniprot ID | P26651 |
Chromosome Location | 19q13.1 |
Pathway | Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Metabolism, organism-specific biosystem; |
Function | AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
ZFP36-313H | Recombinant Human ZFP36 Protein, GST/His-tagged | +Inquiry |
ZFP36-3801H | Recombinant Human ZFP36 Protein, His-tagged | +Inquiry |
ZFP36-18904M | Recombinant Mouse ZFP36 Protein | +Inquiry |
ZFP36-31616TH | Recombinant Human ZFP36 | +Inquiry |
ZFP36-555HF | Recombinant Full Length Human ZFP36 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZFP36 Products
Required fields are marked with *
My Review for All ZFP36 Products
Required fields are marked with *
0
Inquiry Basket