"ANXA6" Related Products

Expand
Expand
Expand

Recombinant Human Annexin A6, His-tagged

Cat. No.: ANXA6-1839H
Product Overview: Recombinant human Annexin A6 fused to His-tag at N-terminus was expressed inE.coliand purified by using conventional chromatography techniques.MW = 78.0 kDa (693aa).
Description: Annexin A6 belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin6 has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Source: E.coli.
Form: Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl.
Purity: > 90% by SDS – PAGE.
Concentration: 0.5 mg/ml (determined by Bradford assay).
Sequences Of Amino Acids: MGSSHHHHHHSSGLVPRGSHMAKPAQGAKYRGSIHDFPGFDPNQDAEALY TAMKG FGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLM RPPA YCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDT SGH FQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRS KQ HLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYFAERL FKAMKGL G TR DNTLIRIMVS RSELDMLDIR EIFRTKYEKS LYSMIKNDTS GEYKKTLLKL SGGDDDAAGQ FFPEAAQVAYQMWELSAVAR VELKGTVRPA NDFNPDADAK ALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLKSEISG DLAR LILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIRAINEAYKED YHKSL ED ALS SDTSGHFRRI LISLATGHRE EGGENLDQAREDAQVAAEIL EIADTPSGDK TSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIV QSV KNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLH QAIEG DTSGD FLKALLALCG GED.
Storage: can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: ANXA6 annexin A6 [ Homo sapiens ]
Synonyms: annexin A6; ANX6; CBP68; ANXA6; p68; p70; CPB-II; annexin-6; calelectrin; lipocortin VI; calphobindin II; calphobindin-II; chromobindin-20; annexin VI (p68); 67 kDa calelectrin; calcium-binding protein p68;Annexin VI; Lipocortin VI; Annexin-6; Protein III; Calphobindin-II; Chromobindin-20
Gene ID: 309
mRNA Refseq: NM_001155
Protein Refseq: NP_001146
MIM: 114070
UniProt ID: P08133
Chromosome Location: 5q32-q34
Function: calcium ion binding; calcium-dependent phospholipid binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.