Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA) protein, His-tagged
Cat.No. : | fbpA-2023M |
Product Overview : | Recombinant Mycobacterium tuberculosis (strain CDC 1551/Oshkosh) Diacylglycerol acyltransferase/mycolyltransferase Ag85A(fbpA) partial protein (53-331aa) was fused to His-tag at N-terminus and expressed in E.coli. |
Availability | May 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Tuberculosis |
Source : | E.coli |
Tag : | His |
Protein Length : | 279 |
Description : | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor (By similarity). |
Form : | Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.1 kDa |
AA Sequence : | YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Expiry : | Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Publications : |
An aptamer for recognizing the transmembrane protein PDL-1 (programmed death-ligand 1), and its application to fluorometric single cell detection of human ovarian carcinoma cells (2017)
Design, isolation and evaluation of the binding efficiency of a DNA aptamer against interleukin 2 receptor alpha, in vitro. (2017)
Selection of DNA aptamers against Mycobacterium tuberculosis Ag85A, and its application in a graphene oxide-based fluorometric assay (2018)
|
Gene Name | fbpA |
Official Symbol | fbpA |
Synonyms | Acyl-CoA; Ag85A; Fbps A; 85A; mpt44 |
Gene ID | 886132 |
Protein Refseq | NP_218321.1 |
UniProt ID | P9WQP2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fbpA Products
Required fields are marked with *
My Review for All fbpA Products
Required fields are marked with *
0
Inquiry Basket