"PLA2G4A" Related Products

Expand

Recombinant Human PLA2G4A, His-tagged

Cat. No.: PLA2G4A-557H
Product Overview: Recombinant Human PLA2G4A is manufactured with N-terminal fusion HisTag. sPLA2-X His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2. It is expressed inEscherichia Coli.
Description: Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.
Source: Escherichia Coli.
Amino Acid Sequence: MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ RDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by SDS PAGE.
Formulation: Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2.
Stability: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. The lyophilized protein remains stable until the expiry date when stored at -20°C.
Gene Name: PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) [ Homo sapiens ]
Synonyms: PLA2G4A; phospholipase A2, group IVA (cytosolic, calcium-dependent); PLA2G4; MGC126350; cPLA2-alpha; PLA2G4A; cytosolic phospholipase A2; cPLA2; lysophospholipase; phospholipase A2 group IVA; phosphatidylcholine 2-acylhydrolase; calcium-dependent phospholipid-binding protein; EC 3.1.1.4; EC 3.1.1.5
Gene ID: 5321
mRNA Refseq: NM_024420
Protein Refseq: NP_077734
MIM: 600522
UniProt ID: P47712
Chromosome Location: 1q25
Pathway: Arachidonic acid metabolism; Ether lipid metabolism; Fc epsilon RI signaling pathway; Fc gamma R-mediated phagocytosisGlycerophospholipid metabolism; GnRH signaling pathway; Long-term depression; MAPK signaling pathway; Vascular smooth muscle contraction; alpha-Linolenic acid metabolism; Opioid Signalling
Function: calcium-dependent phospholipase A2 activity; hydrolase activity; lysophospholipase activity; phospholipase A2 activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.