Cat.No. : |
ACTB-3030H |
Product Overview : |
Recombinant Human β-Actin/ACTB is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe375) of Human ACTB fused with a 6His tag at the C-terminus. |
Description : |
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins. |
Source : |
E. coli |
Species : |
Human |
Tag : |
His |
Form : |
Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, pH 8.0 |
AA Sequence : |
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH |
Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : |
Store at < -20ºC, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Shipping : |
The product is shipped on dry ice/ice packs. |