"ACTB" Related Products

Recombinant Human Actin, Beta, His-tagged

Cat.No. : ACTB-3030H
Product Overview : Recombinant Human β-Actin/ACTB is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe375) of Human ACTB fused with a 6His tag at the C-terminus.
Description : This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Source : E. coli
Species : Human
Tag : His
Form : Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, pH 8.0
AA Sequence : MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20ºC, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name : ACTB actin, beta [ Homo sapiens (human) ]
Official Symbol : ACTB
Synonyms : ACTB; actin, beta; TPT; HHG1; HLP3; PS1TP5BP1; actin, cytoplasmic 1; beta cytoskeletal actin; PS1TP5-binding protein 1; Actin, cytoplasmic 1; Beta-actin; Actin, cytoplasmic 1, N-terminally processed
Gene ID : 60
mRNA Refseq : NM_001101
Protein Refseq : NP_001092
MIM : 102630
UniProt ID : P60709
Chromosome Location : 7p22
Pathway : Adherens junction; Arrhythmogenic right ventricular cardiomyopathy; Bacterial invasion of epithelial cells
Function : ATP binding; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding; Tat protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.