Recombinant Human Actin, Beta, His-tagged ACTB-3030H

Cat.No.:	ACTB-3030H
Product Overview:	Recombinant Human β-Actin/ACTB is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe375) of Human ACTB fused with a 6His tag at the C-terminus.
Description:	This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Source:	E. coli
Species:	Human
Tag:	His
Form:	Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, pH 8.0
AA Sequence:	MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH
Endotoxin:	Less than 0.1 ng/μg (1 IEU/μg).
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage:	Store at < -20ºC, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Shipping:	The product is shipped on dry ice/ice packs.

Download Datasheet

Gene Name:	ACTB actin, beta [ Homo sapiens (human) ]
Official Symbol:	ACTB
Synonyms:	ACTB; actin, beta; TPT; HHG1; HLP3; PS1TP5BP1; actin, cytoplasmic 1; beta cytoskeletal actin; PS1TP5-binding protein 1; Actin, cytoplasmic 1; Beta-actin; Actin, cytoplasmic 1, N-terminally processed
Gene ID:	60
mRNA Refseq:	NM_001101
Protein Refseq:	NP_001092
MIM:	102630
UniProt ID:	P60709
Chromosome Location:	7p22
Pathway:	Adherens junction; Arrhythmogenic right ventricular cardiomyopathy; Bacterial invasion of epithelial cells
Function:	ATP binding; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding; Tat protein binding