"ACTB" Related Products

Expand
Expand

Recombinant Human Actin, Beta, His-tagged

Cat.No.: ACTB-3030H
Product Overview: Recombinant Human β-Actin/ACTB is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Phe375) of Human ACTB fused with a 6His tag at the C-terminus.
Description: This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 0.1% TritonX-100, 2mM DTT, pH 8.0
AA Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP AMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM KIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCFLEHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at < -20ºC, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Shipping: The product is shipped on dry ice/ice packs.
Gene Name: ACTB actin, beta [ Homo sapiens (human) ]
Official Symbol: ACTB
Synonyms: ACTB; actin, beta; TPT; HHG1; HLP3; PS1TP5BP1; actin, cytoplasmic 1; beta cytoskeletal actin; PS1TP5-binding protein 1; Actin, cytoplasmic 1; Beta-actin; Actin, cytoplasmic 1, N-terminally processed
Gene ID: 60
mRNA Refseq: NM_001101
Protein Refseq: NP_001092
MIM: 102630
UniProt ID: P60709
Chromosome Location: 7p22
Pathway: Adherens junction; Arrhythmogenic right ventricular cardiomyopathy; Bacterial invasion of epithelial cells
Function: ATP binding; contributes_to RNA polymerase II core promoter proximal region sequence-specific DNA binding; Tat protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.