Active GMP Recombinant Human IL20 protein
Cat.No. : | IL20-4333HG |
Product Overview : | Recombinant Human IL20 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Human Interleukin-20 (IL-20) is encoded by the IL20 gene located on the chromosome 1 and belongs to the IL-10 family that including IL-10, IL-19, IL-22, IL-24, and IL-26. It is secreted by activated keratinocytes and monocytes, and signals through two distinct cell-surface receptor complexes on keratinocytes and other epithelial cells. IL-20 has functions of regulating proliferation and differentiation of keratinocytes during inflammation, and causing cell expansion of multipotential hematopoietic progenitor cells. |
Form : | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.2, with trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10^6 IU/mg. |
Molecular Mass : | Approximately 17.6 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
AA Sequence : | MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
Endotoxin : | Less than 1 EU/µg of rHuIL-20 as determined by LAL method. |
Purity : | > 95 % by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Reconstitution : | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | IL20 interleukin 20 [ Homo sapiens ] |
Official Symbol | IL20 |
Synonyms | IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907; |
Gene ID | 50604 |
mRNA Refseq | NM_018724 |
Protein Refseq | NP_061194 |
MIM | 605619 |
UniProt ID | Q9NYY1 |
◆ Recombinant Proteins | ||
IL20-7346H | Active Recombinant Human IL20 protein(Leu25-Glu176) | +Inquiry |
Il20-3510M | Recombinant Mouse Il20 Protein, Myc/DDK-tagged | +Inquiry |
IL20-1028H | Recombinant Horse IL20 Protein, His-tagged | +Inquiry |
IL20-268H | Recombinant Human IL20, StrepII-tagged | +Inquiry |
IL20-29664TH | Recombinant Human IL20 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL20-5233HCL | Recombinant Human IL20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL20 Products
Required fields are marked with *
My Review for All IL20 Products
Required fields are marked with *
0
Inquiry Basket