Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Description : |
Interleukin-33 (IL-33), also known as NFHEV and DVS 27, is a 30 kDa proinflammatory protein that may also regulate gene transcription. IL33 is constitutively expressed in smooth muscle and airway epithelia. It is upregulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL1a or IL1β stimulation. IL-33 shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. |
Form : |
Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, 150 mM NaCl, 1 mM EDTA, 2 mM β-Mercaptoethanol, pH 7.4. |
Bio-activity : |
The ED50 determined by a cell proliferation assay using murine D10S cells is less than 0.05 ng/mL, corresponding to a specific activity of >2.0 × 10^7 IU/mg. |
Molecular Mass : |
Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids. |
AA Sequence : |
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
Endotoxin : |
Less than 1 EU/μg of the protein by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw centigrade centigradeles. |
Reconstitution : |
Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Quality Statement : |
Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
Shipping : |
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |