Recombinant Rat Il33 protein

Cat.No. : Il33-583R
Product Overview : Recombinant Rat Il33 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 156
Description : Interleukin-33 (IL-33), also known as NF-HEV and DVS 27, is a cytokine belonging to the IL-1 superfamily. It is also a proinflammatory protein that may regulate gene transcription and it induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. The induction of type 2 cytokines by IL-33 in vivo is believed to induce the severe pathological changes observed in mucosal organs following administration of IL-33. IL-33 is constitutively expressed in smooth muscle and airway epithelia and it binds to a high-affinity receptor family member ST2. In vivo administration of mature IL-33 promotes increased production of IL-5, IL-13, IgE, and IgA, as well as splenomegaly and inflammatory infiltration of mucosal tissues. Recombinant rat IL-3 contains 156 amino acid residues and it shares 59 % a.a. and 90 % sequence identity with human and murine IL-33.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 300 mM NaCl, pH 8.5.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 17.4 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
AA Sequence : SIQGTSLLTESCALSTYNDQSVSFVLENGCYVINVEDCGKNQEKDKVLLRYYESSFPAQSGDGVDGKKLMVNMSPIKDTDIWLNANDKDYSVELQKGDVSPPDQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEENDESCNNIMFKLSKM
Endotoxin : Less than 1 EU/µg of rRtIL-33 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il33
Official Symbol Il33
Synonyms IL-33
Gene ID 361749
mRNA Refseq NM_001014166
Protein Refseq NP_001014188
UniProt ID Q66H70

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il33 Products

Required fields are marked with *

My Review for All Il33 Products

Required fields are marked with *

0
cart-icon