GMP Recombinant Porcine CCL2 Protein, His-Tagged

Cat.No. : CCL2-01P
Product Overview : GMP Recombinant Porcine CCL2 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : CCL2, also known as MCP-1, is belonging to the CC ß chemokine family. CCL2 can be identified in endothelial cells, smooth muscle cells and monocytes as the results of reaction to several atherogenic stimulants, such as CD40 ligand, (IL-1β) and oxidized low density lipoprotein , interleukin-1βplatelet derived growth factor (PDGF). Recent study shows that in vivo MCP1 have several critical roles in atherosclerosis. Additionally, MCP-1 has been proved involving in monocytic infiltration of tissues during several inflammatory diseases, and has been implicated in macrophage-mediated tumor growth inhibition in mice. In addition, CCL2 has been shown to have direct effects on tumor cells in an autocrine and paracrine fashion in multiple cancers, including sarcoma, lung, cervix, ovary, breast, and prostate.
Form : Lyophilized
AA Sequence : QPDAINSPVTCCYTLTSKKISMQRLMSYRRVTSSKCPKEAVIFKTIAGKEICAEPKQKWVQDSISHLDKKNQTPKP with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name CCL2 chemokine (C-C motif) ligand 2 [ Sus scrofa (pig) ]
Official Symbol CCL2
Synonyms MCP-1
Gene ID 397422
mRNA Refseq NM_214214.1
Protein Refseq NP_999379.1
UniProt ID P42831

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL2 Products

Required fields are marked with *

My Review for All CCL2 Products

Required fields are marked with *

0
cart-icon