| Species : |
Porcine |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure. |
| Form : |
Lyophilized |
| AA Sequence : |
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |