GMP Recombinant Porcine IGF1 Protein, His-Tagged
Cat.No. : | IGF1-01P |
Product Overview : | GMP Recombinant Porcine IGF1 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure. |
Form : | Lyophilized |
AA Sequence : | MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | IGF1 insulin like growth factor 1 [ Sus scrofa (pig) ] |
Official Symbol | IGF1 |
Synonyms | IGF-1; IGF-I; Npt2B |
Gene ID | 397491 |
mRNA Refseq | NM_214256.1 |
Protein Refseq | NP_999421.1 |
UniProt ID | P16545 |
◆ Recombinant Proteins | ||
IGF1-377I | Active Recombinant Human IGF1 Protein (71 aa) | +Inquiry |
IGF1-339I | Active Recombinant Human LR3IGF1 Protein (Receptor Grade) | +Inquiry |
IGF1-22H | Recombinant Human/Bovine/Porcine IGF1 Protein | +Inquiry |
IGF1-652H | Active Recombinant Human Insulin Like Growth Factor-I,HIgG1 Fc-tagged | +Inquiry |
IGF1-687H | Recombinant Human Insulin-Like Growth Factor 1 (somatomedin C) | +Inquiry |
◆ Native Proteins | ||
IGF1-23H | Active Recombinant Human IGF-1 LR3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *