Native Full Length Human Prolactin inducible protein

Cat.No. : PIP-17HFL
Product Overview : The Prolactin-Induced Protein produced from Human Seminal Plasma has a molecular mass of 13.52 kDa (calculated without glycosylation) containing 118 amino acid residues.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Plasma
Tag : Non
Description : Prolactin inducible protein (PIP) is a 17 kDa glycoprotein existing in human seminal plasma. PIP is synthesized as a 146 amino acid long polypeptide exhibiting high sequence similarity with mouse submaxillary gland with a single glycosylation site. The precise biological functions of PIP are still ambiguous but various functions have been assigned to PIP due its existence at high concentration in biological fluids. PIP binds to various proteins such as fibrinogen, actin, keratin, myosin and tropomyosin. PIP is also expressed in pathological conditions of the mammary gland and in some exocrine tissues, such as the lacrimal, salivary and sweat glands. Due to PIP's association with secretory cell differentiation, it has been used in diagnostic evaluation of tumors of breast, salivary gland, and skin.
Form : Filtered White lyophilized (freeze-dried) powder.
Molecular Mass : 13.52 kDa
AASequence : QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Purity : Greater than 95% as determined by SDS-PAGE.
Human Virus Test : Samples from each donor have been tested and found negative for HBsAg, HIV1+2, HCV, syphilis, aHBc, RRR.
Solubility : It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. PIP is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
Storage : Store lyophilized protein at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade.
Storage Buffer : PIP protein filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05M phosphate buffer and 0.075M NaCl pH 8.0.
Shipping : Shipped at room temperature.
Gene Name PIP prolactin induced protein [ Homo sapiens (human) ]
Official Symbol PIP
Synonyms PIP; prolactin induced protein; GPIP4; BRST-2; GCDFP15; GCDFP-15; prolactin-inducible protein; SABP; apocrine; gross cystic disease fluid protein 15; secretory actin-binding protein
Gene ID 5304
mRNA Refseq NM_002652
Protein Refseq NP_002643
MIM 176720
UniProt ID P12273

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIP Products

Required fields are marked with *

My Review for All PIP Products

Required fields are marked with *

0
cart-icon
0
compare icon