Native HIV1 PR Protein
| Cat.No. : | PR-01H |
| Product Overview : | Native HIV1 Protease Protein |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HIV |
| Source : | E.coli |
| Protein Length : | 99 |
| Description : | Retroviral protease from HIV-1 virus is an enzyme important in the life cycle of the virus. It is expressed in the infected cells as a part of Gag-Pol polyprotein from which it is autocatalytycaly released after formation of immature viral particle. The enzyme subsequently cleaves the other parts of viral polyproteins causing the maturation of the virus. In HIV-infected patients the enzyme is a subject of intensive mutagenesis and mutants resistant to applied medcines are produced as a consequence of the seletion pressure. HIV-1 protease is active as a homodimer. |
| Molecular Mass : | 10.8 kDa (monomer), protein active as dimer |
| AA Sequence : | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
| Purity : | >95% |
| Applications : | Kinetic studies, Inhibitor screening, Crystallography |
| Quality Control Test : | SDS PAGE to determine purity of the protein. Active site titration by tightly binding inhibitor. |
| Storage : | Store protein at –80 centigrade. Protein remains stable until the expiry date when stored at –80 centigrade. Avoid repeated freezing/thawing cycles. |
| Storage Buffer : | 20 mM sodium acetate, 200 mM NaCl, 10% glycerol, 0.05% 2-mercaptoethanol, 1 mM EDTA, pH 5.0 |
| Reconstitution : | Defrost at ambient temperature. |
| Shipping : | On ice |
| Official Symbol | PR |
| Synonyms | PR; protease; HIV-1 protease; Human immunodeficiency virus protease; PR; Retropepsin |
| ◆ Native Proteins | ||
| PR-01H | Native HIV1 PR Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PR Products
Required fields are marked with *
My Review for All PR Products
Required fields are marked with *
