| Species : |
Human |
| Source : |
Normal human serum |
| Description : |
Natural human C4a is prepared by cleavage of human C4 protein by human C1s. It is produced during activation of both the classical and lectin pathways of complement. C4a is a member of the anaphylatoxin family of three proteins (C3a, C4a and C5a) produced by the activation of complement. Removal of the C-terminal arginine by serum carboxypeptidase N yields C4a desArg and destroys all biological activities of C4a. C4a desArg is an unglycosylated polypeptide containing 76 amino acids with a molecular mass of 8,603 daltons. |
| Form : |
Frozen liquid |
| AASequence : |
NVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQ |
| Molecular Mass : |
8,603 Da (single chain) |
| Extinction Coeff. : |
A276 nm = 0.456 at 1.0 mg/mL |
| Purity : |
>95% by SDS-PAGE |
| Storage : |
At -70 centigrade or below. Avoid freeze/thaw. |
| Storage Buffer : |
HEPES buffered saline, pH 7.2 (No carrier proteins added) |
| Concentration : |
0.5 mg/mL |
